PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_16293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WOX
Protein Properties Length: 278aa    MW: 29486.1 Da    PI: 8.1979
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_16293genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.57.2e-162080257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+t+++eq+ +Le+ Fe+   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  PEQU_16293 20 RSRWTPKPEQILILESIFESgMVNPAKDETVRIRKLLekfgSVGDANVFYWFQNRRSRSRR 80
                79*****************99*************************************997 PP

2Wus_type_Homeobox105.63.2e-342082365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
         PEQU_16293 20 RSRWTPKPEQILILESIFESGMVNPAKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQ 82
                       79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.6611681IPR001356Homeobox domain
SuperFamilySSF466898.98E-141787IPR009057Homeodomain-like
SMARTSM003896.0E-71885IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-92085IPR009057Homeodomain-like
PfamPF000461.6E-132080IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEGNQNSSGN IPPAASEPIR SRWTPKPEQI LILESIFESG MVNPAKDETV RIRKLLEKFG  60
SVGDANVFYW FQNRRSRSRR RQRQIQASLA AASAVVGGGK TTGFEQSAAV AAAMASCSSN  120
CTSSSSSSSS SGGGGGAGFY YGASSSVTPS SVSLLSGFGG SHKADDLFSI SDQMGGLGDD  180
SYMSCYEAAQ MQYQTGSITV FINGIPSEVP SGLINIRAMF GHDAMLIHSS GEPLPINDCG  240
ILLQSLQMGE SYYLVRLKIR CSLSIYISSN IARSHSLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404684.12e-73PREDICTED: WUSCHEL-related homeobox 6-like isoform X1
SwissprotQ0D3I78e-60WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLA0A0D2W7P01e-71A0A0D2W7P0_G
TrEMBLM0SD632e-71M0SD63_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P09460_0015e-71(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.13e-31WUSCHEL related homeobox 11